PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK20565.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family CO-like
Protein Properties Length: 407aa    MW: 43842.6 Da    PI: 4.6394
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK20565.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box17.67.9e-06544639
   zf-B_box  6 CpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
               C+ +++++   +C+++  +lC +C  + H+       H++
  PK20565.1  5 CDYCGDQRSMVYCRSDAACLCLSCDRNVHSAnilskrHSR 44
               *****************************65677777776 PP

2zf-B_box21.64.7e-074689441
   zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg.......Htvvp 41
                +C++++++++   C + ++ lC++C   +H g       H++++
  PK20565.1 46 LICERCHSQPALVRCAEERVSLCQNCDWMGH-GastssstHKRQT 89
               68*****************************.5588888888776 PP

3CCT621.8e-21350393144
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                R+ a++RYkeK+k RkF+K++rY+sRKa+A+ R+RvKGrFvk+ 
  PK20565.1 350 RNDAVMRYKEKKKMRKFDKRVRYASRKARADVRKRVKGRFVKAG 393
                999**************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.471147IPR000315B-box-type zinc finger
CDDcd000211.87E-7447No hitNo description
SMARTSM003362.5E-8447IPR000315B-box-type zinc finger
PROSITE profilePS501198.7024390IPR000315B-box-type zinc finger
CDDcd000218.69E-64790No hitNo description
SMARTSM003360.474890IPR000315B-box-type zinc finger
PROSITE profilePS5101715.348350392IPR010402CCT domain
PfamPF062033.4E-16350392IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005886Cellular Componentplasma membrane
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MGYLCDYCGD QRSMVYCRSD AACLCLSCDR NVHSANILSK RHSRTLICER CHSQPALVRC  60
AEERVSLCQN CDWMGHGAST SSSTHKRQTI RSYSGCPSAA ELSSIWSSIL DSPTGGESTC  120
EQEMGLMSIN ENSSGNDPGP SENASGSVGV NSVTSMAKAS VWPSSSSVPE INAASQVLDL  180
PDESENATFP KLSFPGIKGP ALSANDDLYA DLDMDEVDLN FENYEELFGV ALNNSEELFE  240
NGGIDSLFEA TEMSGADSNC QSAVAAEGSV GQVNAMPACS NAASADSAMS TKTEPLLCFA  300
RQQSSLSFSG PNGETTAGDY QDCGASSMLL LGEPPWCPPS QDASLQSANR NDAVMRYKEK  360
KKMRKFDKRV RYASRKARAD VRKRVKGRFV KAGDVYDYDP LNQTRSC
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010107355.10.0Zinc finger protein CONSTANS-LIKE 9
SwissprotQ9LUA91e-149COL10_ARATH; Zinc finger protein CONSTANS-LIKE 10
TrEMBLW9RWJ70.0W9RWJ7_9R
STRINGGLYMA20G07051.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43623353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48250.11e-123B-box type zinc finger protein with CCT domain